Welcome, please Login here

» Trehalose-6-phosphate hydrolase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0404-144.6 U
    144.6 U
    10.00
  • PRO-E0404-2 mg
    2 mg
    10.00
  • PRO-E0404-1446 U
    1446 U
    70.00
  • PRO-E0404-20 mg
    20 mg
    70.00
  • PRO-E0404-14.46 KU
    14.46 KU
    450.00
  • PRO-E0404-200 mg
    200 mg
    450.00
  • PRO-E0404-144.6 KU
    144.6 KU
    1,950.00
  • PRO-E0404-2 g
    2 g
    1,950.00

Catalogue No.:
PRO-E0404

LOT:
2009-0404

Source Organism:
Bacillus subtilis subsp. subtilis str. 168

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.93

Synonyms:
α,α-Trehalose-6-phosphate phosphoglucohydrolase; α,α-phosphotrehalase; phosphotrehalase; alpha,alpha-trehalose-6-phosphate phosphoglucohydrolase; alpha,alpha-phosphotrehalase

Nomenclature:
CAZy [GH13 subf29, glycoside hydrolase family 13 subfamily 29, member of clan GH-H], TreA, TreC, BSU07810, O34517

Specific Activity:
78.3 U/mg (5 mM PNPG)

Accession No.:
P39795, NP_388662.1, BG11010, BSUB224308:BSU0781-MON

Molecular Weight:
68727.7 Da

Biological Function:
α,α-Trehalose 6-phosphate + H2O <=> D-glucose + D-glucose 6-phosphate

Comments:
This is a cytoplasmic enzyme

Primary Sequence


MKTEQTPWWKKAVVYQIYPKSFNDTTGNGVGDLNGIIEKLDYLKTLQVDVLWLTPIYDSPQHDNGYDIRD
YYSIYPEYGTMEDFERLVSEAHKRDLKVVMDLVVNHTSTEHKWFREAISSIDSPYRDFYIWKKPQENGSV
PTNWESKFGGSAWELDEASGQYYLHLFDVTQADLNWENEEVRKHVYDMMHFWFEKGIDGFRLDVINLISK
DQRFPNAEEGDGRSFYTDGPRVHEFLHEMNEKVFSHYDSMTVGEMSSTTVDHCIRYTNPDNKELDMTFSF
HHLKVDYPNGEKWALAPFDFLKLKEILSDWQTGMHAGGGWNALFWCNHDQPRVVSRYGDDGAYRVKSAKM
LATAIHMMQGTPYIYQGEELGMTNPKFTDISSYRDVESLNMYHAFKEKGMADQDITAILQAKSRDNSRTP
VQWDATENGGFTTGTPWIPVAGNYREINAEAALRDQNSVFYHYQKLIQIRKMYDIVTEGTYEIIAKDDPN
IFAYLRHGSNEKLLVINNFYGTEAAFTLPDSLAPDEWKAEVLLTNDEAREGLQNMTLRPYESIVYRLTKP
C