Welcome, please Login here

» α-Amylase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0412-36.25 U
    36.25 U
    10.00
  • PRO-E0412-1 mg
    1 mg
    10.00
  • PRO-E0412-362.5 U
    362.5 U
    70.00
  • PRO-E0412-10
    10
    70.00
  • PRO-E0412-3625 U
    3625 U
    550.00
  • PRO-E0412-100 mg
    100 mg
    550.00
  • PRO-E0412-36.25 KU
    36.25 KU
    2,500.00
  • PRO-E0412-1 g
    1 g
    2,500.00

Catalogue No.:
PRO-E0412

LOT:
2009-0412

Source Organism:
Bacteroides fragilis NCTC 9343

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.1

Synonyms:
Glycogenase; α amylase, α-amylase; endoamylase; Taka-amylase A; 1,4-α-D-glucan glucanohydrolase; 4-α-D-glucan glucanohydrolase; alpha-amylase; alpha amylase, alpha-amylase; 1,4-alpha-D-glucan glucanohydrolase; 4-alpha-D-glucan glucanohydrolase

Nomenclature:
CAZy [GH13 subf5, glycoside hydrolase family 13 subfamily 5, member of clan GH-H], cytoplasmic α-amylase, BF3048

Specific Activity:
36.25 U/mg (soluble starch)

Accession No.:
Q5LAX9, YP_212662.1

Molecular Weight:
59099.7 Da

Biological Function:
Endohydrolysis of (1->4)-α-D-glucosidic linkages in oligosaccharides and polysaccharides

Comments:
This cytoplasmic enzyme acts on starch, glycogen and related polysaccharides

Primary Sequence


MENGVMMQYFEWNLPNDGNLWKQLKEDASHLHEIGVTAVWIPPAYKADEQQDEGYATYDLYDLGEFDQKE
TVRTKYGTKEELKEMIDELHKNHISVYLDVVLNHKAGGDFTEKFIVVEVDPNDRTQALGKPFEIQGWTGY
SFHGRKDKYSDFKWHWYHFSGTGFDDAKKRSGIFQIQGEGKAWSEGVDNENGNYDFLLCNDIDLDHPEVV
TELNRWGKWVSKELNLDGMRLDAIKHMKDKFIAQFLDAVRSERGDKFYAVGEYWNGDLNTLDAYIKSVGH
KVNLFDVPLHYNLFQASQEGKNYDLQNILKNTLVGHHCDLAVTFVDNHDSQSGSSLESQIEDWFKPLAYG
LILLIKDGYPCLFYGDYYGVKGENSPHTQIINILLDARRKYAYGDQIEYFDHPSAIGFIRTGDEEHVGSG
LVFLMSNDEAGSKKMDLGEEHKGEIWHEITGNIQQEITLDEKGSGEFSVNTRNIAVWIKKN