Welcome, please Login here

» Glycogen branching enzyme

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0413-50.88 U
    50.88 U
    10.00
  • PRO-E0413-1 mg
    1 mg
    10.00
  • PRO-E0413-508.8 U
    508.8 U
    70.00
  • PRO-E0413-10 mg
    10 mg
    70.00
  • PRO-E0413-5088 U
    5088 U
    450.00
  • PRO-E0413-100 mg
    100 mg
    450.00
  • PRO-E0413-50.88 KU
    50.88 KU
    1,950.00
  • PRO-E0413-1 g
    1 g
    1,950.00

Catalogue No.:
PRO-E0413

LOT:
2010-0413-2

Source Organism:
Bacteroides fragilis NCTC 9343

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
2.4.1.18

Synonyms:
Branching enzyme; amylo-(1,4→1,6)-transglycosylase; Q-enzyme; α-glucan-branching glycosyltransferase; amylose isomerase; enzymatic branching factor; branching glycosyltransferase; enzyme Q; glucosan transglycosylase; glycogen branching enzyme; plant branching enzyme; α-1,4-glucan:α-1,4-glucan-6-glycosyltransferase; starch branching enzyme; 1,4-α-D-glucan:1,4-α-D-glucan 6-α-D-(1,4-α-D-glucano)-transferase

Nomenclature:
CAZy [GH13 subf8, glycoside hydrolase family 13 subfamily 8, member of clan GH-H], BF2338, GlgB

Specific Activity:
50.88 U/mg (pH 7.0; 3.3 mg/mL starch)

Accession No.:
Q5LCX9, YP_211960.1, CAH08034.1, BFRA272559:BF2338-MON

Molecular Weight:
81104.6 Da

Biological Function:
Catalyses the transfer of a segment of a (1→4)-α-D-glucan chain to a primary hydroxy group in a similar glucan chain. Involved with glycogen synthesis

Comments:
This is a cytoplasmic enzyme

Primary Sequence


MEKTLNLIKNDPWLEPYKDAIVGRFEHAMDKKAELTNGGKSTLSDFASGYLYFGLHRTDKGWIFREWAPN
ASHIYMVGTFSNWEEKPAYKLKRLKNGSWEIKLPIDTIQHGDLYKLHVYWEGGQGERIPAWANRVVQDDN
TKIFSAQVWAPEKPFKFKKKTFKPSTDPLLIYECHIGMAQQEEKVGTYNEFREKILPRIAKEGYNCIQIM
AIQEHPYYGSFGYHVSSFFAASSRFGTPEELKQLIDTAHGLGIAVIMDIVHSHAVKNEVEGLGNFAGDPN
QYFYPGGRREHPAWDSLCFDYGKNEVMHFLLSNCKYWLEEYHFDGFRFDGVTSMLYYSHGLGEAFCNYGD
YFNGHQDDNAICYLTLANELIHEVNPKAITIAEEVSGMPGLAAKVEDGGYGFDYRMAMNIPDYWIKTIKE
KIDEDWKPSSMFWEVTNRRQDEKTISYAESHDQALVGDKTIIFRLIDADMYWHMQKGDENYIVHRGVALH
KMIRLLTASTINGGYLNFMGNEFGHPEWIDFPREGNGWSCKYARRQWDLVDNKNLTYHYLGDFDADMLKV
IKSVKNIQQTPVQEIWHNDGDQVLAYQRKDLVFVFNFNPSQSFTDYGFLVTPGTYEVVLNTDNIIYGGNG
LSDDSVKHFTLPDPLYKKEKKEWLKLYIPARTAMVLRRTK