Welcome, please Login here

» Pullulanase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to GBP.

Under Development

Catalogue No.:
PRO-E0414

LOT:
2009-0414

Source Organism:
Bacteroides fragilis NCTC 9343

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.41

Synonyms:
Limit dextrinase (erroneous); amylopectin 6-glucanohydrolase; bacterial debranching enzyme; debranching enzyme; α-dextrin endo-1,6-α-glucosidase; R-enzyme; pullulan α-1,6-glucanohydrolase; pullulan 6-α-glucanohydrolase; alpha-dextrin endo-1,6-alpha-glucosidase; pullulan alpha-1,6-glucanohydrolase; pullulan 6-alpha-glucanohydrolase

Nomenclature:
CAZy [GH13 subf14, glycoside hydrolase family 13 subfamily 14, member of clan GH-H], BF3100

Specific Activity:
-

Accession No.:
Q5LAS8_BACFN, YP_212713.1, CAH08795.1, BFRA272559:BF3100-MON

Molecular Weight:
75996.7 Da

Biological Function:
Catalyses the hydrolysis of (1→6)-α-D-glucosidic linkages in pullulan, amylopectin and glycogen, and in the α- and β-limit dextrins of amylopectin and glycogen

Comments:
Different to limit dextrinase (EC 3.2.1.142)

Primary Sequence


CTPAKKEYASYELYPVRSGSLTEMEYSPESTKFTLWAPTADEVRLMLFDSGEGGHAYETIPMEPGEEGTW
MATVRKDLMGKFYTFNVKVNDKWMGDTPGINAKAVGVNGKRAAIINLKSTDPQGWETDQRPPLKSPADAI
IYEMHHRDFSVDSTSGIQHKGKFLALTEHGTMNSAKLLTGIDHLIELGVTHVHLLPSYDYASVDETKLDE
NKYNWGYDPQNYNVPDGSYATDPYDPAVRIREFKQMVQALHKAGIRVVLDVVYNHTYNTDGSNFERTVPG
YFYRQKPDGSLANGSACGNETASNRPMMRKYMIESVLHWIREYHIDGFRFDLMGIHDIETMNEIRKAVSA
VDPSIIIYGEGWAAEAPQYPGDSLAMKVNTCKMPGIAAFSDEMRDALRGPFNDNHKGAFLAGIPGEEESI
KFGIVGAVSHPQVNNDSVNYSKAPWASQPTQMISYVSCHDDMCLVDRLKSSIPGITPEQLVRLDKLAQTA
VLTSQGIPFIYAGEEVMRDKKGVHNSFESPDSINAIDWNRKTTHEDVFAYYKRLISIRKAHPAFRMGDAE
MVRKYLEFLPVDGGNLVAFRLKDRANGDTWDNIIVALNARSVPAKLAIPEGKYTVVCRDGVIDERGLGSL
YGPEVTVPAQSALIIHQ