Welcome, please Login here

» Cyclomaltodextrin glucanotransferase

  • GBP
  • Euro
  • USD

Under Development

Catalogue No.:
PRO-E0415

LOT:
2009-0415

Source Organism:
Streptococcus pyogenes M1 GAS SF370

Enzyme Properties


EC No.:
2.4.1.19

Synonyms:
Bacillus macerans amylase; cyclodextrin glucanotransferase; α-cyclodextrin glucanotransferase; α-cyclodextrin glycosyltransferase; β-cyclodextrin glucanotransferase; β-cyclodextrin glycosyltransferase; γ-cyclodextrin glycosyltransferase; cyclodextrin glycosyltransferase; cyclomaltodextrin glucotransferase; cyclomaltodextrin glycosyltransferase; konchizaimu; α-1,4-glucan 4-glycosyltransferase, cyclizing; BMA; CGTase; neutral-cyclodextrin glycosyltransferase; 1,4-α-D-glucan 4-α-D-(1,4-α-D-glucano)-transferase (cyclizing); (1→4)-α-D-glucan 4-α-D-[(1→4)-α-D-glucano]-transferase (cyclizing); alpha-cyclodextrin glucanotransferase; alpha-cyclodextrin glycosyltransferase; beta-cyclodextrin glucanotransferase; beta-cyclodextrin glycosyltransferase; gamma-cyclodextrin glycosyltransferase; alpha-1,4-glucan 4-glycosyltransferase, cyclizing; 1,4-alpha-D-glucan 4-alpha-D-(1,4-alpha-D-glucano)-transferase (cyclizing); (1→4)-alpha-D-glucan 4-alpha-D-[(1→4)-alpha-D-glucano]-transferase (cyclizing)

Nomenclature:
CAZy [GH13 subf2, glycoside hydrolase family 13 subfamily 2, member of clan GH-H]

Specific Activity:
-

Accession No.:
AAK34149

Molecular Weight:
83365.1 Da

Biological Function:
Cyclizes part of a (1→4)-α-D-glucan chain by formation of a 1→4)-α-D-glucosidic bond

Comments:
-

Primary Sequence


MRELHIKTYKLLTKSAVLLGLISFPLTVSAADNASVTNKADFSTDTIYQIVTDRFNDGNTSNNGKTDVFD
KNDLKKYHGGDWQGIIAKIKDGYLTDMGISAIWISSPVENIDSIDPSNGSAAYHGYWAKDFFKTNQHFGT
EADFQQLVKVAHQHHIKVVIDFAPNHTSTAEKEGTTFKEDGALYKNGKLVGKFSDDKDKIFNHESWTDFS
TYENSIYHSMYGLADLNNINPKVDQYMKEAIDKWLDLGVDGIRVDAVKHMSQGWQKNWLSHIYEKHNVFV
FGEWFSGHTDDDYDMTTFANNSGMGLLDFRFANAIRQLYTGFSTFTMRDFYKVLENRDQVTNEVTDQVTF
IDNHDMERFATKVANNQTAVNQAYALLLTSRGVPNIYYGTEQYATGDKDPNNRGDMPSFNKESQAYKVIS
KLAPLRKQNQALAYGTTEQRWISDHVLVFERKFGNHVALVAINRDQTNGYTITNAKTALPQNSYKDKLEG
LLGGQELIVGADGTISSFELGAGQVAVWTYEGEDKTPQLGDVDASVGIAGNKITISGQGFGNSKGQVTFG
EISAEILSWSDTLITLKVPTVPANYYNISVTTADKQTSNSYQAFEVLTDKQIPVRLLINDFKTVPGEQLY
LMGDVFEMGANDAKNAVGPLFNNTQTIAKYPNWFFDTHLPINKEIAVKLVKKDSIGNVLWTSPETYSIKT
GHEAQTITIKK