Welcome, please Login here

» Amylosucrase

  • GBP
  • Euro
  • USD

Under Development

Catalogue No.:
PRO-E0417

LOT:
2009-0417

Source Organism:
Caulobacter crescentus CB15

Enzyme Properties


EC No.:
2.4.1.4

Synonyms:
Sucrose—glucan glucosyltransferase; sucrose-1,4-α-glucan glucosyltransferase; sucrose:1,4-α-D-glucan 4-α-D-glucosyltransferase; sucrose:(1→4)-α-D-glucan 4-α-D-glucosyltransferase; sucrose-1,4-alpha-glucan glucosyltransferase; sucrose:1,4-alpha-D-glucan 4-alpha-D-glucosyltransferase; sucrose:(1→4)-alpha-D-glucan 4-alpha-D-glucosyltransferase

Nomenclature:
CAZy [GH13 subf4, glycoside hydrolase family 13 subfamily 4, member of clan GH-H]

Specific Activity:
-

Accession No.:
AAK23119

Molecular Weight:
67052.7 Da

Biological Function:
Catalyses the reaction: sucrose + [(1→4)-α-D-glucosyl]n = D-fructose + [(1→4)-α-D-glucosyl]n+1

Comments:
-

Primary Sequence


MESRFAKLYGADARGPAVLERLKTNLLKAAHARPEPLRALDAARAADPAWLHAPGQTAYTFYVDRFAGDL
NGVRGKLDYLTELGVRWLHPLPLLEPRPGDSDGGFAVADYRKVDPRLGTIDDLEALAGDLRQRDMGLILD
VVCNHTAREHAWAAKARAGDPAYRDYYIVLPDAQSAAARDRELIDVFPDTAPGSFTYDAAMGGYVWTTFY
PFQWDLNYANPAVFAEMLEVLIFLAAKGAQGFRLDSAPFLWKQAGTTCRNLPQTYEIVEAWRAALSIVAP
GVVLLAEAIESVEDVLPFFGGEESGCNLAYNNVVMTALWAALADGDAVIARRCLAVAARKPAQGAWLNYV
RCHDDLIWNALAAYAPASDLRRWSNAYGNGEGFSRGRAFQTAEGGVPSTNGMAAALAGLTADADGDCLGA
RRLRLLYGIIHALDGWPLIYMGDEIGLDNDEAYQDDPLRAGDGRWLHRPQMDWSLAERRGEAGALQADLF
ATFARLGQRARRLATLGVAGPARPVEVSSPAVLAFLRDEGARPFLCVANVSDAPQDFELPPAFAQGAEDV
LDGAPSPAGAVSLPPYGITWLVAR