Welcome, please Login here

» Maltooligosyl trehalose trehalohydrolase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to Euro.

  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0418-1 mg
    1 mg
    11.90
  • PRO-E0418-10 mg
    10 mg
    83.30
  • PRO-E0418-100 mg
    100 mg
    535.50
  • PRO-E0418-1 g
    1 g
    3,213.00

Catalogue No.:
PRO-E0418

LOT:
2009-0418

Source Organism:
Bradyrhizobium sp. BTAi1

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.141

Synonyms:
4-α-D-{(1→4)-α-D-Glucano}trehalose trehalohydrolase; 4-α-D-(1,4-α-D-glucano)trehalose glucanohydrolase (trehalose-producing); 4-alpha-D-{(1→4)-alpha-D-glucano}trehalose trehalohydrolase; 4-alpha-D-(1,4-alpha-D-glucano)trehalose glucanohydrolase (trehalose-producing)

Nomenclature:
CAZy [GH13 subf10, glycoside hydrolase family 13 subfamily 10, member of clan GH-H]

Specific Activity:
-

Accession No.:
A5EPZ9, YP_001242149.1

Molecular Weight:
69634.7 Da

Biological Function:
Catalyses the hydrolysis of (1→4)-α-D-glucosidic linkage in 4-α-D-[(1→4)-α-D-glucanosyl]n trehalose to yield trehalose and (1→4)-α-D-glucan

Comments:
-

Primary Sequence


MSGRQFGPRLSEHGTSFRLWAPAARRVDLVLDDGRREMQRRDGGWYALDAPGIGAGTRYKFRIDDELDVP
DPGSDFQPEDVSGPSEVIDHCAYVWRAKDWRGRPWQDAVFLESHVGTFTEEGTYRAMIDKLDHLVETGIT
ALELMPLADFAGRRNWGYDGVLLYAPDSVYGRPDDLRALIDEAHLRGLMVFLDVVYNHFGPEGNYIARYA
PTFFTDTHTPWGSAIDYRRPEVRAFAIENALHWLTDYRFDGLRFDAVNHILSNEGEIPMLHELSAAVGRL
VAQTGRHIHLVLENGDNRASMLDAAEEPPRGKFRAQWNDDYHHVWHVMLTGETTGYYGDYQDNPRGGLAR
ALASGFVYQGEQAAFWGGIRRGEPSGHLAPGAFVNFLQNHDQIGNRVFGDRLEALAPPEGIAAALAVTLL
APTVPMLYMGEEWGSKQPFPFFCDFQGDLAHAVRKGRRKEYEWAYAKYGDEVPDPLDVETFRSAIIDWDA
RNEPPGRERLALVRDLLAVRHSKVAPLLPGATFGAADVTDEGRLTAHWTMGDGSQLRLLANVSDKEIAGP
SNDVNGTPIWGGTPGDRLPPWSVYWSIGG