Welcome, please Login here

» Malto-oligosyltrehalose synthase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to GBP.

Under Development

Catalogue No.:
PRO-E0424

LOT:
2009-0424

Source Organism:
Streptomyces coelicolor A3(2)

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
5.4.99.15

Synonyms:
(1→4)-α-D-Glucan 1-α-D-glucosylmutase; maltodextrin α-D-glucosyltransferase; (1→4)-α-D-glucan 1-α-D-glucosylmutase; (1→4)-alpha-D-Glucan 1-alpha-D-glucosylmutase; maltodextrin alpha-D-glucosyltransferase; (1→4)-alpha-D-glucan 1-alpha-D-glucosylmutase

Nomenclature:
CAZy [GH13 subf26, glycoside hydrolase family 13 subfamily 26, member of clan GH-H], TreY, SCO6081, SCBAC1A6.05c

Specific Activity:
-

Accession No.:
Q9ADI2, NP_630189.1, SCOE100226:SCO6081-MON

Molecular Weight:
91024.4 Da

Biological Function:
Catalyses the reaction: 4-[(1→4)-α-D-glucosyl]n-1-D-glucose = 1-α-D-[(1→4)-α-D-glucosyl]n-1-α-D-glucopyranoside

Comments:
Does not act on maltose

Primary Sequence


MTPERPSPVSPASVPSATYRLQLQPSFPFKAAAAAVPYLASLGVSHLHLSPVLEAVPGSLHGYDVVDHAR
VRAELGGEEGLRALSRTAREHGLGLVVDIVPNHMAMSPRHNHALWEVLREGPSSPYARWFDIDWQAQDGR
LLLPVLGAPLGEVLDDLRVDGDVLRYHEHAFPLRDGTADLPLPRLLDAQWYRPVWWRLARTELNYRRFFS
ISELIGVRVEDPEVFEATHGTVLRLLHEGVIDGLRVDHPDGLADPDAYLERLHRASGGRWTVVEKILADG
ERLPAAWPVAGTTGYDALRHVDGLFTDPAGYGQLLDRYRRFAAPQADLGGDWAATVRRAAYEVLTHELAT
ELDRLTRVAHRLCAAAPDPALRDRAPWALRTALVELLVRLEVYRPYTSVDAAAVVTEEAAAGARHAFTVP
EEAGAVDVVRGLVLGRYGDGPDHVEFRTRFAQTASALRAKSVEDTAFYRYVPLLSATEVGGDPGRPAVSP
QEFHAYCARVQRDWPATGTVVSTHDTKRSADVRAALAVLTQCPARWADVLTEAAGATGTDEGPPDGQLAW
AAWQTVFGLGPADRERVREALLKHVREAGTHTTWTEQDPSYEEAVARFVAAGPGGAPGARVTALREALAP
HIRANVLGTALVHLTMPGVPDLYQGTEHEYLALVDPDNRRAVDFPAAGDEGWAWGPGAKAAVTRAALALR
ARRPGVFGDTGTYEPLPAEGPAAAHCVAFARSGRTVTAVTRLSLRLAEAGGWRGTTLPLPPGRWADALAP
GREFAGDARVADLFADTPVALLERVEEAGTRWNGG