Welcome, please Login here

» α-Glucosidase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0425

LOT:
2009-0425

Source Organism:
Streptomyces coelicolor A3(2)

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.20

Synonyms:
Maltase; acid maltase; glucoinvertase; glucosidosucrase; lysosomal α-glucosidase; maltase-glucoamylase; α-glucopyranosidase; glucosidoinvertase; α-D-glucosidase; α-glucoside hydrolase; α-1,4-glucosidase; α-D-glucoside glucohydrolase; alpha-glucosidase; alpha-glucopyranosidase; alpha-D-glucosidase; alpha-glucoside hydrolase; alpha-1,4-glucosidase; lysosomal alpha-glucosidase; alpha-D-glucoside glucohydrolase

Nomenclature:
CAZy [GH13 subf30, glycoside hydrolase family 13 subfamily 30, member of clan GH-H], SCO7010, SC8F11.36c, algA

Specific Activity:
-

Accession No.:
Q9KZE3, NP_631075.1, SCOE100226:SCO7010-MON

Molecular Weight:
62975.3 Da

Biological Function:
Hydrolysis of terminal, non-reducing (1→4)-linked α-D-glucose residues with release of α-D-glucose

Comments:
Specificity directed mainly towards the exohydrolysis of 1,4-α-glucosidic linkages (hydrolyse oligosaccharides rapidly, polysaccharides poorly or not at all)

Primary Sequence


MAAPNSHRAEDWWRDAVIYQVYPRSFADGDGDGTGDLAGVRARLPYLAELGVDAVWFTPWYVSPLVDGGY
DVADYRTIDPAFGTLGEAEKLIAEARELGIRTIVDIVPNHVSDRHAWFRAALEAGPGSAERERFHFRPGR
GADGELPPNDWPSQFSGRTWTRVPDGEWYLHLFTPEQPDLNWAHPEVRREHEEVLRFWFERGVAGVRIDS
AALLAKDPALADFVEGVDPHPYIDQDELHDIYRSWRKVADEYGGVFVGEVWLPDAERFARYLRPDELHTA
FNFNFLSCPWEADRLRRTIDDTLAEHAPVGAPATWVLCNHDVTRTVTRYGRADTGFDFAKKAFGTPTDLV
LGTRRARAAALLTLALPGSVYLYQGEELGLPEADIPRDRIQDPMHFRSGGVDPGRDGCRVPLPWAADAPY
CGFGSETEPWLPQPEGWAAYAADRQGADPESMLSLYRRALGLRRSTAGFGDGGLDWLPAPDGVLAFRRAG
GPVCVVNLSAAPVELPAHSAVLLVSGPLDEAGRLPADTAVWLRA