Welcome, please Login here

» α-Amylase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0427

LOT:
2009-0427

Source Organism:
Streptomyces coelicolor A3(2)

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.1

Synonyms:
Glycogenase; α amylase, α-amylase; endoamylase; Taka-amylase A; 1,4-α-D-glucan glucanohydrolase; 4-α-D-glucan glucanohydrolase; alpha-amylase; alpha amylase, alpha-amylase; 1,4-alpha-D-glucan glucanohydrolase; 4-alpha-D-glucan glucanohydrolase

Nomenclature:
CAZy [GH13 subf32, glycoside hydrolase family 13 subfamily 32, member of clan GH-H], SCO7020, SC1H10.09, AmlB

Specific Activity:
-

Accession No.:
Q9L035, NP_631084.1, SCOE100226:SCO7020-MON

Molecular Weight:
54343.5 Da

Biological Function:
Endohydrolysis of (1→4)-α-D-glucosidic linkages in polysaccharides containing three or more (1→4)-α-linked D-glucose units

Comments:
Acts on starch, glycogen and related polysaccharides and oligosaccharides in a random manner; reducing groups are liberated in the α-configuration

Primary Sequence


SPPGDKDVTAVMFEWKFTSVAQACTDTLGPAGYGYVQVSPPQEHIQGGQWWTSYQPVSYRIAGRLGDRAQ
FKSMVDTCHAAGVKVVADSVVNHMSAGNGTGTGGSSYTKYDYPGLYSSNDLDNCTSQINNYGDRFNVQEC
ELVGLADLDTGEDYVRGKIAGYLNDLLSLGVDGFRIDAAKHMAAADLAAIKSRLSNPNVYWKHEAIYGAG
EAVSPTEYVGSGDVQEFRYARDLKRVFNGENLAYLKNFGEAWGHLPSDEAAVFVTNHDTERNGETLTYKD
GATYTLAHVFMLAWPYGSPDVHSGYEFTDHDAGPPNGGQVNACYSDGWKCQHAWREISSMVGFRNTARGQ
GVTDWWDNGGDQIAFGRGSKAYVAINHEGTSLTRTFQTSLPAGDYCDVQTGKGVTVDGAGRFTATLGAGT
AVALHVGARTCDGGDPGDPDPVSSGVSFAVDATTSWGQNIYVTGNRPELGN