Welcome, please Login here

» α-2,3/2,6-Sialyltransferase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0269-1 mg
    1 mg
    10.00
  • PRO-E0269-10 mg
    10 mg
    70.00
  • PRO-E0269-100 mg
    100 mg
    450.00
  • PRO-E0269-1 g
    1 g
    2,700.00

Catalogue No.:
PRO-E0269

LOT:
2010-0269-1

Source Organism:
Pasteurella multocida

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
2.4.99.1, 2.4.99.4, 3.2.1.-

Synonyms:
Alpha-2,3/2,6-sialyltransferase/sialidase; β-galactoside α-2,6-sialyltransferase; CMP-N-acetylneuraminate:β-D-galactosyl-1,4-N-acetyl-β-D-glucosamine α-2,6-N-acetylneuraminyltransferase; β-galactoside α-2,3-sialyltransferase; CMP-N-acetylneuraminate:β-D-galactoside α-2,3-N-acetylneuraminyl-transferase; CMP-N-acetylneuraminate:β-D-galactoside α-(2→3)-N-acetylneuraminyl-transferase; beta-galactoside alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate:beta-D-galactosyl-1,4-N-acetyl-beta-D-glucosamine alpha-2,6-N-acetylneuraminyltransferase; beta-galactoside alpha-2,3-sialyltransferase; CMP-N-acetylneuraminate:beta-D-galactoside alpha-2,3-N-acetylneuraminyl-transferase; CMP-N-acetylneuraminate:beta-D-galactoside alpha-(2→3)-N-acetylneuraminyl-transferase

Nomenclature:
CAZy [GT80, glycosyltransferase family 80, member of fold GT-B]

Specific Activity:
-

Accession No.:
Q15KI8

Molecular Weight:
46240.5

Biological Function:
-

Comments:
-

Primary Sequence


MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTI
LDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQA
EKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLT
PEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHY
KIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSN
KQVKSKEDALNNPYVKVMRRLGIIDESQVIFWDSLKQL