Welcome, please Login here

» α-L-Arabinofuranosidase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0102

LOT:
2008-0102

Source Organism:
Bacillus subtilis subsp. Subtilis str. 168

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.55

Synonyms:
α-N-Arabinofuranosidase, arabinofuranosidase, arabinosidase

Nomenclature:
CAZy [GH51, glycoside hydrolase family 51, member of clan GH-A], arabinofuranosidase 51A

Specific Activity:
-

Accession No.:
CAA99595.1

Molecular Weight:
60460.0 Da

Biological Function:
Hydrolysis of terminal non-reducing α-L-arabinofuranoside residues in α-L-arabinosides (acts on α-L-arabinofuranosides, alpha-L-arabinans containing (1,3)- and/or (1,5)-linkages, arabinoxylans and arabinogalactans)

Primary Sequence


MKKARMIVDKEYKIGEVDKRIYGSFIEHMGRAVYEGIYEPDHPEADEDGFRKDVQSLIKELQVPIIRYPG
GNFLSGYNWEDGVGPVENRPRRLDLAWQTTETNEVGTNEFLSWPKKVNTEVNMAVNLGTRGIDAARNLVE
YCNHPKGSYWSDLRRSHGYEQPYGIKTWCLGNEMDGPWQIGHKTADEYGRLAAETAKVMKWVDPSIELVA
CGSSNSGMPTFIDWEAKVLEHTYEHVDYISLHTYYGNRDNNLPNYLARSMDLDHFIKSVAATCDYVKAKT
RSKKTINLSLDEWNVWYHSNEADKKVEPWITARPILEDIYNFEDALLVGSLLITMLQHADRVKIACLAQL
VNVIAPIMTEKGGEAWRQPIFYPYMHASVYGRGESLKPLISSPKYDCSDFTDVPYVDAAVVYSEEEETLT
IFAVNKAEDQMETEISLRGFESYQIAEHIVLEHQDIKATNQHNRKNVVPHSNGSSSVSENGLTAHFTPLS
WNVIRLKKQS