Welcome, please Login here

» β-Glucosidase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0103

LOT:
2008-0103

Source Organism:
Bacteroides fragilis NCTC 9343

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.21

Synonyms:
Gentiobiase; cellobiase; emulsin; elaterase; aryl-β-glucosidase; β-D-glucosidase; β-glucoside glucohydrolase; arbutinase; amygdalinase; p-nitrophenyl β-glucosidase; primeverosidase; amygdalase; limarase; salicilinase; β-1,6-glucosidase; β-D-glucoside glucohydrolase; aryl-beta-glucosidase; beta-D-glucosidase; beta-glucoside glucohydrolase; p-nitrophenyl beta-glucosidase; beta-1,6-glucosidase; beta-D-glucoside glucohydrolase

Nomenclature:
CAZy [GH3, glycoside hydrolase family 3]

Specific Activity:
-

Accession No.:
CAH06053.1

Molecular Weight:
95215.7 Da

Biological Function:
Hydrolysis of terminal, non-reducing β-D-glucosyl residues with release of β-D-glucose

Comments:
Wide specificity for β-D-glucosides (may also hydrolyse β-D-galactosides, α-L-arabinosides, β-D-xylosides, and/or β-D-fucosides)

Primary Sequence


MKATTSLATSCRRLLLWGVLTLQCLFSTAQKRFTADVEQQAEKILSQMTLDEKLSYIGGINWMYTRPLER
FGIPRLKMSDGPQGLGTHGPSTAYPCALMLAATWNEQLATEYGSALGKDCRARGVHVLLGPAVNIYRAPM
CGRNFEYMGEDPYLTSRMATGYIKGVQGQGVMATIKHFIANNSDYDRDHISSDIDERTLNEIYFPSFRAA
VQEAEVGAVMSSYNLLNGIYTTEHPWLLKDVLRQQWGFKGILMSDWGSTHHCIPAVKGGLDLEMPAGSKM
QPEELKYYLRTGDITIETIDEKVRHILQTLLAFGFRETQQPDTHIPLKNPQCAQTALNVASEGLVLLKNT
NQILPIRSGKVKTIAVVGKNAQGYVCGGGSGEVHPFQYVSVLDGIRKEAAERDIRVEYLDVYDYLPTIIF
TDTERKQKGFRAQYFDNMNLEGTPKVEQTETKINYSWSGGTGLKEMPKEQFSVRWNGTICPQETDEYLFT
LGGDDGYRLYIDGKLIADEWHEGAFRNSTYRCMLEAGKKYDLKIEYFQKGGGAAVNFIWKQKNASNNLFV
EALNRNDLVVACIGFNSDTEGEGRDRTFELPEDEAQLLQNTLQSKRPVVGIVNAGGNVEMQSWEPSLKGL
LWAWYGGQEAGTAIARTLFGELNPSGKLPITFEKRWEDNPTFHSYYDPDGDKHVEYAEGIFVGYRGYDKL
KREVQYPFGYGLSYTRFKLSAPTVGTPKTDGSVTVTCKLTNTGRTAGAEVVQLYVSNKDTTVEHPEKELK
GFRKVYLEPGETKSIEITVPAEAFSHYDTGSRRFVIDRGSHDILLGFSSRDIKAKMSVGISR