Welcome, please Login here

» α-Galactosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0001-180
    180U
    51.00
  • PRO-E0001-540
    540U
    138.00

Catalogue No.:
PRO-E0001

LOT:
2008-0001

Source Organism:
Cellvibrio mixtus ATCC 12120

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.22

Synonyms:
Melibiase; α-D-galactosidase; α-galactosidase A; α-galactoside galactohydrolase; α-D-galactoside galactohydrolase; alpha-galactosidase; alpha-D-galactosidase; alpha-galactosidase A; alpha-galactoside galactohydrolase; alpha-D-galactoside galactohydrolase

Nomenclature:
CAZy [GH27, glycoside hydrolase family 27, belongs to clan GH-D], Aga27A, CmAga27A

Specific Activity:
150 U/mg

Accession No.:
AAS19696

Molecular Weight:
44582.3 Da

Biological Function:
Hydrolysis of terminal, non-reducing α-D-galactose residues in α-D-galactosides, including galactose oligosaccharides and galactomannans

Comments:
This enzyme is a truncated form lacking the C-terminal and N-terminal dockerin domains

Primary Sequence


MQKFEHLAKTPQLGWNSWNTFACDVNEKMIREMADAMVASGMKDAGYEYINIDDCWHGERDKQGFIQVDK
KSFPSGMKALADYVHSKGLKLGIYSDAGNTTCAGRPGSRGHEYQDAVTYASWGIDYVKYDWCDTKDINPK
AAYATMRDAIHKAGRPMLFSICEWGDNKPWEWATDVGHSWRTTGDIYPCWNCEHNHGSWSSWGVLPILDK
QAGLRKYAGPGHWNDMDMMEVGNGMNEDEDRAHFSLWAMMASPLIAGNDLRKMSEATKKILTNKDMLAIN
QDKLGIQAMKWIDEGDIEIYVKPLEKGDYAVLFLNRADTTVNYSLDWGFHYMKDDISKHEIFFDKKKFNW
RDIWNGGKGSTAEKLNLTMAAHSVAVLRLTPQ