Welcome, please Login here

» β-Glucosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0105-27.7
    27.7U
    10.00
  • PRO-E0105-1
    1mg
    10.00
  • PRO-E0105-277
    277U
    70.00
  • PRO-E0105-10
    10mg
    70.00
  • PRO-E0105-2774
    2774U
    450.00
  • PRO-E0105-100
    100mg
    450.00

Catalogue No.:
PRO-E0105

LOT:
2008-0105

Source Organism:
Bacteroides fragilis NCTC 9343

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.21

Synonyms:
Gentiobiase; cellobiase; emulsin; elaterase; aryl-β-glucosidase; β-D-glucosidase; β-glucoside glucohydrolase; arbutinase; amygdalinase; p-nitrophenyl β-glucosidase; primeverosidase; amygdalase; limarase; salicilinase; β-1,6-glucosidase; β-D-glucoside glucohydrolase; aryl-beta-glucosidase; beta-D-glucosidase; beta-glucoside glucohydrolase; p-nitrophenyl beta-glucosidase; beta-1,6-glucosidase; beta-D-glucoside glucohydrolase

Nomenclature:
CAZy [GH3, glycoside hydrolase family 3]

Specific Activity:
27.7 U/mg (pH 4.4)

Accession No.:
Q5LIB6, YP_210072.1, BFRA272559:BF0339-MON

Molecular Weight:
83500.1 Da

Biological Function:
Hydrolysis of terminal, non-reducing β-D-glucosyl residues with release of β-D-glucose

Comments:
No detectable activity against either pNP-α-D-galactopyranoside or pNP-β-D-xylopyranoside

Primary Sequence


KPPQDMDRFLDNLLKRMTLEEKIGQLNLPVTGEITTGQAKSSDIATKIKRGEVGGLFNLKGVDKIRDVQH
LAVENSRLGIPLLFGMDVIHGYETIFPIPLGLSCTWDIPAIEESARIAAVEASADGISWTFSPMVDISRD
PRWGRVSEGSGEDPFLGALIARAMVRGYQGKDMSRNDEIMACIKHFALYGAAEAGRDYNTVDMSRQRMFN
DYMLPYQAGVEAGAGSVMASFNEVEGVPATANKWLMTDVLRGAWGFNGFVVTDFTGISEMIEHGIGDLQT
VSARAINAGVDMDMVSEGFIGTLKKSVEEGKVSVETVNTACRRILEAKYKLGLFDNPYKYCDLKRPARDI
FTKEHRAAARKIAGESFVLLKNEGLSPTLAPVLPLSPTGTIAVIGPLANTRSNMPGTWSVAAVLDKSPSL
VEGLTEWVGNQGKILYAKGSNLIGDAAYEERATMFGRSLNRDNRTDQQLLDEALKIASQADVIVAALGES
SEMSGESSSRTNLNLPDVQHTLLEALLKTGKPVVLVLFTGRPLVLNWEQEHVPAILNVWFGGSEAGPAIG
DVLFGAVNPGGKLTMTFPKSVGQIPLYYAHKNTGRPLKEGKWFEKFRSNYLDVDNDALYPFGYGLSYTTF
RFSDITLNRSSIGMDNELVASVTVTNTGDRAGSEVVQLYIRDLVGSVTRPVKELKGFEKIYLQPNESRTV
RFTIAPEMLKFYNADLKFVAEPGDFDVMIGPDSRNVKTARFTLH