Welcome, please Login here

» Acetyl xylan esterase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0053-150.1
    150.1U
    10.00
  • PRO-E0053-1
    1mg
    10.00
  • PRO-E0053-1501
    1501U
    90.00
  • PRO-E0053-10
    10mg
    90.00
  • PRO-E0053-15010
    15010U
    800.00
  • PRO-E0053-100
    100mg
    800.00

Catalogue No.:
PRO-E0053

LOT:
2008-0053

Source Organism:
Cellvibrio japonicus NCIMB 10462

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.72

Synonyms:
Acetylxylan esterase

Nomenclature:
CAZy [CE2, carbohydrate esterase family 2], ce2A, axe2C, CJA_0450, pJF120, 02530

Specific Activity:
150.1 U/mg

Accession No.:
B3PIB0, ACE84991.1, YP_001980973.1

Molecular Weight:
37304.6 Da

Biological Function:
Hydrolyses 4-nitrophenyl acetate and releases

Comments:
PDB: 2WAA

Primary Sequence


MSDPHIQVMGRTHINDDASLTFGYPGVSLSTIVAGSRLTAEMQSSNGNSWIDVIIDNHPPTSIKLDAQQQ
TVELFHFPNSGEHRVEIIHRSENWHGQVTLKQLTLTGTQFLPAPVLPQRKILVLGDSVTCGEAIDRVAGE
DKNTRWWNARESYGMLTAKALDAQVQLVCWGGRGLIRSWNGKTDDANLPDFYQFTLGDTGQAPQWDHHRY
QPDLIISAIGTNDFSPGIPDRATYINTYTRFVRTLLDNHPQATIVLTEGAILNGDKKAALVSYIGETRQQ
LHSNRVFYASSSHHPGDNSDAHPTKDQHAAMARELTPQLRQIMDW