Welcome, please Login here

» α-L-Arabinofuranosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0002-31
    31U
    51.00
  • PRO-E0002-93
    93U
    138.00

Catalogue No.:
PRO-E0002

LOT:
2011-0002-1 (11071)

Source Organism:
Clostridium thermocellum ATCC 27405

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.55

Synonyms:
α-N-Arabinofuranosidase; arabinosidase; α-arabinosidase; α-L-arabinosidase; α-arabinofuranosidase;polysaccharide α-L-arabinofuranosidase; α-L-arabinofuranoside hydrolase; L-arabinosidase; α-L-arabinanase; α-L-arabinofuranoside arabinofuranohydrolase; alpha-N-arabinofuranosidase; alpha-arabinosidase; alpha-L-arabinosidase; alpha-arabinofuranosidase;polysaccharide alpha-L-arabinofuranosidase; alpha-L-arabinofuranoside hydrolase; alpha-L-arabinanase; alpha-L-arabinofuranoside arabinofuranohydrolase

Nomenclature:
CAZy [GH51, glycoside hydrolase family 51, belongs to clan GH-A], arabinofuranosidase 51A, CtAraf51A

Specific Activity:
125 U/mg

Accession No.:
ABN53749

Molecular Weight:
58765.7 Da

Biological Function:
Catalyses the hydrolysis of terminal non-reducing α-L-arabinofuranoside residues in α-L-arabinosides

Comments:
The enzyme acts on α-L-arabinofuranosides, α-L-arabinans containing (1,3)- and/or (1,5)-linkages, arabinoxylans and arabinogalactans

Primary Sequence


MKKARMTVDKDYKIAEIDKRIYGSFVEHLGRAVYDGLYQPGNSKSDEDGFRKDVIELVKELNVPIIRYPG
GNFVSNYFWEDGVGPVEDRPRRLDLAWKSIEPNQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLE
YCNHPGGSKYSDMRIKHGVKEPHNIKVWCLGNEMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVA
CGSSSKDMPTFPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKK
RSKKDIYLSFDEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACL
AQLINVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEEK
EEVTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSSFDDGILTSM
LRRASWNVIRIGK