Welcome, please Login here

» β-1,3-Glucanase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0003-4500
    4500U
    51.00
  • PRO-E0003-13.4 KU
    13.4 KU
    138.00

Catalogue No.:
PRO-E0003

LOT:
2012-0003 (Batch 09091)

Source Organism:
Clostridium thermocellum ATCC 27405

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.39

Synonyms:
Glucan endo-1,3-β-D-glucosidase; endo-1,3-β-glucanase; laminarinase; laminaranase; oligo-1,3-glucosidase; callase; β-1,3-glucanase; kitalase; 1,3-β-D-glucan 3-glucanohydrolase; endo-(1,3)-β-D-glucanase; (1→3)-β-glucan 3-glucanohydrolase; endo-1,3-β-D-glucanase; endo-1,3-β-glucosidase; 1,3-β-D-glucan glucanohydrolase; 3-β-D-glucan glucanohydrolase; glucan endo-1,3-beta-D-glucosidase; endo-1,3-beta-glucanase; beta-1,3-glucanase; 1,3-beta-D-glucan 3-glucanohydrolase; endo-(1,3)-beta-D-glucanase; (1→3)-beta-glucan 3-glucanohydrolase; endo-1,3-beta-D-glucanase; endo-1,3-beta-glucosidase; 1,3-beta-D-glucan glucanohydrolase; 3-beta-D-glucan glucanohydrolase

Nomenclature:
CAZy [GH81, glycoside hydrolase family 81], Lam81A, Cthe_0660

Specific Activity:
1500 U/mg

Accession No.:
ABN51895

Molecular Weight:
82262.8 Da

Biological Function:
Catalyses the hydrolysis of (1→3)-β-D-glucosidic linkages in (1→3)-β-D-glucans

Comments:
Different from endo-1,3(4)-β-glucanase (EC 3.2.1.6). Hydrolyses laminarin, paramylon and pachyman, with less activity on mixed-linkage (1,3-1,4-)-β-D-glucans

Primary Sequence


MQYYREGTGSYTVVLPPGAKVPQAEIYKTSNLQGAVPTNSWESSILWNQYSLPIYAHPLTFKFKAEGIEV
GKPALGGSGIAYFGAHKNDFTVGHSSVYTFPDARADKISDFAVDAVMASGSGSIKATLMKGSPYAYFVFT
GGNPRIDFSGTPTVFYGDSGSQCLGVTINGVNYGLFAPSGSKWQGIGTGTITCILPAGKNYFSIAVLPDN
TVSTLTYYKDYAYCFVTDTKVEWSYNETESTLTTTFTAEVSVKEGTNKGTILALYPHQWRNNPHILPLPY
TYSTLRGIMKTIQGTSFKTVYRYHGILPNLPDKGTYDREALNRYINELALQADAPVAVDTYWFGKHLGKL
SCALPIAEQLGNISAKDRFISFMKSSLEDWFTAKEGETAKLFYYDSNWGTLIGYPSSYGSDEELNDHHFH
YGYFLHAAAQIALRDPQWASRDNWGAMVELLIKDIANWDRNDTRFPFLRNFDPYEGHSWASGHAGFADGN
NQESSSEAINAWQAIILWGEATGNKTIRDLGIYLYTTEVEAVCNYWFDLYKDIFSPSYGHNYASMVWGGK
YCHEIWWNGTNSEKHGINFLPITAASLYLGKDPNYIKQNYEEMLRECGTSQPPNWKDIQYMYYALYDPAA
AKNMWNESIVPEDGESKAHTYHWICNLDSLGLPDFSVTADTPLYSVFNKNNIRTYVVYNASSSAKKVTFS
DGKVMTVGPHSMAVSTGSESE