Welcome, please Login here

» β-Glucosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0110-159.5
    159.5U
    10.00
  • PRO-E0110-1
    1mg
    10.00
  • PRO-E0110-1595
    1595U
    70.00
  • PRO-E0110-10
    10mg
    70.00
  • PRO-E0110-15953
    15953U
    450.00
  • PRO-E0110-100
    100mg
    450.00

Catalogue No.:
PRO-E0110

LOT:
2008-0110

Source Organism:
Rhizobium etli CFN 42

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.21

Synonyms:
Gentiobiase; cellobiase; emulsin; elaterase; aryl-β-glucosidase; β-D-glucosidase; β-glucoside glucohydrolase; arbutinase; amygdalinase; p-nitrophenyl β-glucosidase; primeverosidase; amygdalase; limarase; salicilinase; β-1,6-glucosidase; β-D-glucoside glucohydrolase; aryl-beta-glucosidase; beta-glucosidase; beta-D-glucosidase; beta-glucoside glucohydrolase; p-nitrophenyl beta-glucosidase; beta-1,6-glucosidase; beta-D-glucoside glucohydrolase

Nomenclature:
CAZy [GH1, glycoside hydrolase family 1, member of clan GH-A]

Specific Activity:
159.5 U/mg (pH 5.4)

Accession No.:
Q2K441

Molecular Weight:
53741.8 Da

Biological Function:
Hydrolysis of terminal, non-reducing β-D-glucosyl residues with release of β-D-glucose

Comments:
No detectable activity against pNP-α-D-galactopyranoside. Activity against pNP-β-D-xylopyranoside is 1.93 U/mL (0.9758 U/mg)

Primary Sequence


MIDANTLAGRFPGDFTFGVATAAFQIEGASKADGRKPSIWDAFCNMPGRVHNRDNGDVACDHYNRLEQDL
DLVKEMGVEAYRFSIAWPRIIPDGTGPVNEAGLDFYDRLVDGCKARGIKTFATLYHWDLPLLLAGDGGWT
ARSTAYAFQRYAKTVMSRLGDRLDAVATFNEPWCIVWLSHLYGIHAPGERNMQAALHAMHYMNLAHGLGV
EAIRSEAPNVPVGLVLNAASIIASSTSPADLAAAERAHQFHNGAFFDPVFKGEYPKAFVQALGDRMPVIE
DGDLKVISQKLDWWGLNYYTPERVTDDADRKGDFPWTVKAPPASEVKTDIGWEIYAPGLKLLVEDLYRRY
ELPDCYITENGACDNTGVADGEVDDTMRLDYLGDHLDVLADLIKDGYPLRGYFAWSLMDNFEWAEGYRMR
FGLVHVDYETQRRTVKKSGKWYRDLAGQFPKGNHKPG