Welcome, please Login here

» Aldehyde reductase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0375-2 mg
    2 mg
    88.00
  • PRO-E0375-6 mg
    6 mg
    175.00

Catalogue No.:
PRO-E0375

LOT:
2009-0375

Source Organism:
Escherichia coli

Enzyme Properties


EC No.:
1.1.1.-

Synonyms:
Alcohol dehydrogenase

Nomenclature:
b3011, JW2978, yqhD

Specific Activity:
See product specification sheet for activity data

Accession No.:
Q46856, AP_003562.1, NP_417484.1, EcoCyc:G7564-MON

Molecular Weight:
38987.4 Da

Biological Function:
YqhD catalyses the NADPH-dependent reduction of various membrane peroxidation derived aldehydes, including acetaldehyde, propanaldehyde, butanaldehyde, acrolein and malondialdehyde (MDA)

Comments:
Homodimeric enzyme

Primary Sequence


MNNFNLHTPTRILFGKGAIAGLREQIPHDARVLITYGGGSVKKTGVLDQVLDALKGMDVLEFGGIEPNPA
YETLMNAVKLVREQKVTFLLAVGGGSVLDGTKFIAAAANYPENIDPWHILQTGGKEIKSAIPMGCVLTLP
ATGSESNAGAVISRKTTGDKQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVTKPVDA
KIQDRFAEGILLTLIEDGPKALKEPENYDVRANVMWAATQALNGLIGAGVPQDWATHMLGHELTAMHGLD
HAQTLAIVLPALWNEKRDTKRAKLLQYAERVWNITEGSDDERIDAAIAATRNFFEQLGVPTHLSDYGLDG
SSIPALLKKLEEHGMTQLGENHDITLDVSRRIYEAAR