Welcome, please Login here

» Feruloyl esterase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0030-25
    25U
    51.00
  • PRO-E0030-75
    75U
    138.00

Catalogue No.:
PRO-E0030

LOT:
2010-0030-3 (batch 10101)

Source Organism:
Clostridium thermocellum

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.73

Synonyms:
Ferulic acid esterase; hydroxycinnamoyl esterase; hemicellulase accessory enzyme; FAE-III; cinnamoyl ester hydrolase; FAEA; cinnAE; FAE-I; FAE-II; 4-hydroxy-3-methoxycinnamoyl-sugar hydrolase

Nomenclature:
CAZy [CE1, carbohydrate esterase family 1], N-terminal CE1 catalytic module of XynZ

Specific Activity:
0.1 U/mg (methyl ferulate)

Accession No.:
P10478

Molecular Weight:
29600 Da

Biological Function:
Hydrolyses FAXX, FAX3 and PAX3

Comments:
This esterase is the N-terminal CE1 catalytic module of XynZ from Clostridium thermocellum and catalyses the hydrolysis of the 4-hydroxy-3-methoxycinnamoyl (feruloyl) group from an esterified sugar, which is usually arabinose in "natural" substrates. Methyl ferulate is a poorer substrate. Microbial ferulate esterases are secreted into the culture medium. They are sometimes called hemicellulase accessory enzymes, since they help xylanases and pectinases to break down plant cell wall hemicellulose

Primary Sequence


MAASLPTMPPSGYDQVRNGVPRGQVVNISYFSTATNSTRPARVYLPPGYSKDKKYSVLYLLHGIGGSEND
WFEGGGRANVIADNLIAEGKIKPLIIVTPNTNAAGPGIADGYENFTKDLLNSLIPYIESNYSVYTDREHR
AIAGLSMGGGQSFNIGLTNLDKFAYIGPISAAPNTYPNERLFPDGGKAAREKLKLLFIACGTNDSLIGFG
QRVHEYCVANNINHVYWLIQGGGHDFNVWKPGLWNFLQMADEAGLTRDGNT