Welcome, please Login here

» Feruloyl esterase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0356-1 mg
    1 mg
    10.00
  • PRO-E0356-1.17 U
    1.17 U
    10.00
  • PRO-E0356-10 mg
    10 mg
    70.00
  • PRO-E0356-11.7 U
    11.7 U
    70.00
  • PRO-E0356-100 mg
    100 mg
    450.00
  • PRO-E0356-117 U
    117 U
    450.00
  • PRO-E0356-1 g
    1 g
    1,500.00
  • PRO-E0356-1.2 KU
    1.2 KU
    1,500.00

Catalogue No.:
PRO-E0356

LOT:
2012-0356-1

Source Organism:
Acetivibrio cellulolyticus

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.73

Synonyms:
Ferulic acid esterase; hydroxycinnamoyl esterase; FAE-III; cinnamoyl ester hydrolase; FAEA; cinnAE; FAE-I; FAE-II; 4-hydroxy-3-methoxycinnamoyl-sugar hydrolase

Nomenclature:
Belongs to CE family 1 (CE1)

Specific Activity:
1.169 U/mg

Accession No.:
ZP_09465527

Molecular Weight:
32631.3 Da

Biological Function:
Biological ester hydrolysis.

Comments:
This esterase is the N-terminal CE1 catalytic module from a modular enzyme comprising additionally a C-terminal CBM6 module and dockerin sequence.

Primary Sequence


AAIQPTIPPSGYDQVRNNISHGQVLNISYYSNATKSQRPARVYLPSGYSSSNKYSVMYLLHGIGGSENDW
TLGGGSANVIADNLIADGKIKPSIIVMPQCNAELPGDATNYGYERFTDDLIYSLVPYIESKYSVDTDPLH
RSISGLSMGGGQSFNIGLPHVDMFPYVGAYSAAPNTYSSDKLFPDGGTKAKQNLKLLFICCGTSDGLISF
GRNVHTFCDSKSIPNTYWELEGRPHDWSVWKPGLWNYLQMLEDVGYTSQTTST