Welcome, please Login here

» Alcohol dehydrogenase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0601-50mg
    50mg
    50.00
  • PRO-E0601-1g
    1g
    450.00
  • PRO-E0601- 10g
    10g
    1,550.00
  • PRO-E0601-100g
    100g
    4,500.00
  • PRO-E0601-1kg
    1kg
    9,900.00
  • PRO-E0601-Bulk-enquire
    Bulk-enquire
    0.00

Catalogue No.:
PRO-E0601

LOT:
2012-1

Source Organism:
Homo sapiens (Human)

Enzyme Properties


EC No.:
1.1.1.2

Synonyms:
Aldehyde reductase, Aldo-keto reductase family 1 member A1

Specific Activity:
-

Accession No.:
P14550

Molecular Weight:
36573.0 Da

Comments:
This biocatalyst can be acquired by regular purchase as a crude CFE powder/cake, or in pure form by inquiring at sales@prozomix.com

Primary Sequence


MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV
PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY
KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY
SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT
FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY