Welcome, please Login here

» Acetyl xylan esterase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0034-112.5
    112.5U
    51.00
  • PRO-E0034-337.5
    337.5U
    138.00

Catalogue No.:
PRO-E0034

LOT:
2008-0034

Source Organism:
Clostridium thermocellum ATCC 27405

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.72

Synonyms:
Acetylxylan esterase

Nomenclature:
CAZy [CE3, carbohydrate esterase family 3], CE3A

Specific Activity:
45 U/mg

Accession No.:
ABN52033

Molecular Weight:
24000 Da

Biological Function:
Deacetylation of xylans and xylo-oligosaccharides

Comments:
Also catalyses the hydrolysis of acetyl groups from acetylated xylose, acetylated glucose, α-napthyl acetate, and p-nitrophenyl acetate

Primary Sequence


MKTIKIMPVGDSCTEGMGGGEMGSYRTELYRLLTQAGLSIDFVGSQRSGPSSLPDKDHEGHSGWTIPQIA
SNINNWLNTHNPDVVFLWIGGNDLLLNGNLNATGLSNLIDQIFTVKPNVTLFVADYYPWPEAIKQYNAVI
PGIVQQKANAGKKVYFVKLSEIQFDRNTDISWDGLHLSEIGYKKIANIWYKYTIDILRALAGETQ