Welcome, please Login here

» Acetyl xylan esterase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0035-10.5
    10.5U
    51.00
  • PRO-E0035-31.5
    31.5U
    138.00

Catalogue No.:
PRO-E0035

LOT:
2008-0035

Source Organism:
Clostridium thermocellum F1 / YS

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.72

Synonyms:
Acetylxylan esterase

Nomenclature:
CAZy [CE4, carbohydrate esterase family 4], CE4

Specific Activity:
7 U/mg

Accession No.:
BAA33543

Molecular Weight:
47900 Da

Biological Function:
Deacetylation of xylans and xylo-oligosaccharides

Comments:
PDB: 2C71, 2C79. Also catalyses the hydrolysis of acetyl groups from acetylated xylose, acetylated glucose, α-napthyl acetate, and p-nitrophenyl acetate

Primary Sequence


MKIESEEYNSLKSSTIQTIGTSDGGSGIGYIESGDYLVFNKINFGNGANSFKARVASGADTPTNIQLRLG
SPTGTLIGTLTVASTGGWNNYEEKSCSITNTTGQHDLYLVFSGPVNIDYFIFDSNGVNPTPTSQPQQGQV
LGDLNGDKQVNSTDYTALKRHLLNITRLSGTALANADLNGDGKVDSTDLMILHRYLLGIISSFPRSNPQP
SSNPQPSSNPQPTINPNAKLVALTFDDGPDNVLTARVLDKLDKYNVKATFMVVGQRVNDSTAAIIRRMVN
SGHEIGNHSWSYSGMANMSPDQIRKSIADTNAVIQKYAGTTPKFFRAPNLETSPTLFNNVDLVFVGGLTA
NDWIPSTTAEQRAGAVINGVRDGTIILLHDVQPEPHPTPEALDIIIPTLKSRGYEFVTLTELFTLKGVPI
DPSVKRMYNSVP