Welcome, please Login here

» Acetyl xylan esterase

  • GBP
  • Euro
  • USD

Under Development

Catalogue No.:
PRO-E0322

LOT:
2008-0322

Source Organism:
Opitutus terrae PB90-1

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.72

Synonyms:
Acetylxylan esterase

Nomenclature:
CAZy [CE1, carbohydrate esterase family 1]

Specific Activity:
-

Accession No.:
ACB76502

Molecular Weight:
44249.6 Da

Biological Function:
Deacetylation of xylans and xylo-oligosaccharides

Comments:
Also catalyses the hydrolysis of acetyl groups from acetylated xylose, acetylated glucose, α-napthyl acetate, and p-nitrophenyl acetate

Primary Sequence


MKISLPSALRCIVCSLGLTLTLSAQPSGSRPPPIDSPVVHPDRTATFKFRAPNAQKVELSGQFLRSSQPL
QKDESGVWSITVGPIEPNLYPYNFVVDGLGVADPANQDIFPNERFKASLVDIPGEQPSMYAVRDVPHGEL
TTCYYHSKPLNRTRPLIVYTPPGYRAGTDKYPAFYLVSGTTDTEETWVKVGRVNFILDNLIAAKRAVPMI
VVMPYGNMMMGMPRPDTPEVAGMYQVFNEELLGNILPYVEANYRVIADREHRAIAGFSRGGGQSLFTGFN
NLDQFAYIGSYSAYLTAAVFDKHFPRVSADPAATNRQLKLLWLGVGKSDFLYPQAIAFMDLMKERKLEHR
TLITEGGHTWMNARHYLYETLQLYFK