Welcome, please Login here

» Pectate lyase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to USD.

  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0250-583
    583U
    $15.00
  • PRO-E0250-1
    1mg
    $15.00
  • PRO-E0250-5834
    5834U
    $105.00
  • PRO-E0250-10
    10mg
    $105.00
  • PRO-E0250-58335
    58335U
    $675.00
  • PRO-E0250-100
    100mg
    $675.00

Catalogue No.:
PRO-E0250

LOT:
2008-0250

Source Organism:
Cellvibrio japonicus NCIMB 10462

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
4.2.2.2

Synonyms:
Polygalacturonic transeliminase; pectic acid transeliminase; polygalacturonate lyase; endopectin methyltranseliminase; pectate transeliminase; endogalacturonate transeliminase; pectic acid lyase; pectic lyase; α-1,4-D-endopolygalacturonic acid lyase; PGA lyase; PPase-N; endo-α-1,4-polygalacturonic acid lyase; polygalacturonic acid lyase; pectin trans-eliminase; polygalacturonic acid trans-eliminase; (1→4)-α-D-galacturonan lyase; alpha-1,4-D-endopolygalacturonic acid lyase; endo-alpha-1,4-polygalacturonic acid lyase; (1→4)-alpha-D-galacturonan lyase

Nomenclature:
CAZy [PL10, polysaccharide lyase family 10], Pel10A, Pel10Acm

Specific Activity:
100.7 U/mg

Accession No.:
Q9F7L3; AF279264

Molecular Weight:
38035.2 Da

Biological Function:
Catalyses the eliminative cleavage of (1→4)-α-D-galacturonan to give oligosaccharides with 4-deoxy-α-D-galact-4-enuronosyl groups at their non-reducing ends. Shows a preference for pectate over pectin

Comments:
Pel10Acm comprises the C-terminal PL10 catalytic module (residues 327-649) from Pel10A from Cellvibrio japonicus NCIMB 10462 (formerly Pseudomonas fluorescens subsp. cellulosa)

Primary Sequence


TGRMLTLDGNPAANWLNNARTKWSASRADVVLSYQQNNGGWPKNLDYNSVGNGGGGNESGTIDNGATITE
MVFLAEVYKSGGNTKYRDAVRKAANFLVNSQYSTGALPQFYPLKGGYSDHATFNDNGMAYALTVLDFAAN
KRAPFDTDVFSDSDRTRFKTAVTKGTDYILKAQWKQNGVLTVWCAQHGALDYQPKKARAYELESLSGSES
VGVLAFLMTQPQTAEIERAVRAGVAWFNSPRTYLEGYTYDSSLAATNPIVPRAGSKMWYRFYDLNTNRGF
FSDRDGSKFYDITQMSLERRTGYSWGGNYGTSIINFAQKVGYL